PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.J8PPF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 558aa    MW: 62563.6 Da    PI: 6.8551
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.J8PPFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.42.8e-27333386256
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   +++Wtp LH++Fv+aveqL G+++A+P+++lelmkv+gLt+++v+SHLQkYRl+
  Araip.J8PPF 333 LKVDWTPALHKKFVQAVEQL-GIDQAIPSRVLELMKVEGLTRHNVASHLQKYRLH 386
                  5899****************.********************************97 PP

2Response_reg26.14.2e-10391451109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                   vl+ + + + ++ +r  le  +y +v ++ d  eal  + ++   +++ ++ ++ +    G+++l++    +++lp i+ ++++  +++ +++ +Ga
   Araip.J8PPF  39 VLLLERDSTSASEIRAKLEAMDY-HVSTFYDENEALSEISNRLegFHVAIVEVSTSSsQRGFKFLEN----AKDLPTIMTSDTQCLSTMMKCIALGA 130
                   67777788888999999******.***************777667*******999997789988864....34799********************* PP

                   SEEEESS--HHHHHH CS
  Response_reg  95 kdflsKpfdpeelvk 109
                    +fl Kp ++++l++
   Araip.J8PPF 131 VEFLCKPLSEDKLRN 145
                   ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521728.4E-1435153IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.3E-1535179No hitNo description
PROSITE profilePS5011019.89538151IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.7E-739146IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.05E-740150No hitNo description
PROSITE profilePS5129414.802329388IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-26330389IPR009057Homeodomain-like
SuperFamilySSF466892.51E-17331389IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24332387IPR006447Myb domain, plants
PfamPF002491.2E-6335384IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
KYLYVVLVFR GLSDDAKPAM VCTANDLHGW KDFPKGLRVL LLERDSTSAS EIRAKLEAMD  60
YHVSTFYDEN EALSEISNRL EGFHVAIVEV STSSSQRGFK FLENAKDLPT IMTSDTQCLS  120
TMMKCIALGA VEFLCKPLSE DKLRNIWQHV VHKAFNAGAS VLSESLKPVK ESVESILQLQ  180
TENGHHESKI SIDLENISRF SDNYHEQSAG SDKYPAPSTP QLKQGARLLD DGDCQEHTNC  240
SNEKESGEHE GESKSVEASS ENLNEGTQPQ KPEETLIKQE EDFVADGSNG ESTVPLNPHD  300
RRSLRSTNGN ITSPNKAVVL SDTCQNKANR KKLKVDWTPA LHKKFVQAVE QLGIDQAIPS  360
RVLELMKVEG LTRHNVASHL QKYRLHKRQM MPKEDRRWQN QRDTVRWKRP VMAYPPVYPM  420
WGQSGTQTTG AQFWGPPGYT WLRPTENWHW KPFPGVHVDA WGCPVLPATQ APYLSYTQHM  480
AGLHNGKSAD YRYGMPPSSF EHYPADEVVD KVVKEAISKP WLPLPLGLKP PSTDSVLAEL  540
SRQGISPIPL DSKGSKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-14330385358ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016201528.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-143APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0B2SEA70.0A0A0B2SEA7_GLYSO; Two-component response regulator-like APRR2
STRINGGLYMA01G40900.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-140ARR-B family protein